RRP8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20557
Artikelname: RRP8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20557
Hersteller Artikelnummer: A20557
Alternativnummer: ABB-A20557-100UL,ABB-A20557-20UL,ABB-A20557-1000UL,ABB-A20557-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NML, KIAA0409, RRP8
Enables methylated histone binding activity. Involved in several processes, including cellular response to glucose starvation, intrinsic apoptotic signaling pathway by p53 class mediator, and regulation of gene expression. Located in several cellular components, including cytosol, nuclear lumen, and rDNA heterochromatin. Part of chromatin silencing complex.
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 23378
UniProt: O43159
Reinheit: Affinity purification
Sequenz: GPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHAPINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKN
Target-Kategorie: RRP8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using RRP8 Rabbit pAb (A20557) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.