RRP8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20557
Article Name: RRP8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20557
Supplier Catalog Number: A20557
Alternative Catalog Number: ABB-A20557-100UL,ABB-A20557-20UL,ABB-A20557-1000UL,ABB-A20557-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NML, KIAA0409, RRP8
Enables methylated histone binding activity. Involved in several processes, including cellular response to glucose starvation, intrinsic apoptotic signaling pathway by p53 class mediator, and regulation of gene expression. Located in several cellular components, including cytosol, nuclear lumen, and rDNA heterochromatin. Part of chromatin silencing complex.
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 23378
UniProt: O43159
Purity: Affinity purification
Sequence: GPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHAPINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKN
Target: RRP8
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using RRP8 Rabbit pAb (A20557) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.