INTS6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20602
Artikelname: INTS6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20602
Hersteller Artikelnummer: A20602
Alternativnummer: ABB-A20602-100UL,ABB-A20602-500UL,ABB-A20602-20UL,ABB-A20602-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HDB, INT6, DBI-1, DDX26, DICE1, DDX26A, Notchl2, INTS6
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3 end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 100kDa
NCBI: 26512
UniProt: Q9UL03
Reinheit: Affinity purification
Sequenz: HKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN
Target-Kategorie: INTS6
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics and Nuclear Signaling,DNA / RNA,RNA Processing. Shipping: Ice Bag
Western blot analysis of various lysates using INTS6 Rabbit pAb (A20602) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.