INTS6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20602
- Bilder (1)
| Artikelname: | INTS6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20602 |
| Hersteller Artikelnummer: | A20602 |
| Alternativnummer: | ABB-A20602-100UL,ABB-A20602-500UL,ABB-A20602-20UL,ABB-A20602-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HDB, INT6, DBI-1, DDX26, DICE1, DDX26A, Notchl2, INTS6 |
| DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3 end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 100kDa |
| NCBI: | 26512 |
| UniProt: | Q9UL03 |
| Reinheit: | Affinity purification |
| Sequenz: | HKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN |
| Target-Kategorie: | INTS6 |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics and Nuclear Signaling,DNA / RNA,RNA Processing. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using INTS6 Rabbit pAb (A20602) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
