INTS6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20602
Article Name: INTS6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20602
Supplier Catalog Number: A20602
Alternative Catalog Number: ABB-A20602-100UL,ABB-A20602-500UL,ABB-A20602-20UL,ABB-A20602-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HDB, INT6, DBI-1, DDX26, DICE1, DDX26A, Notchl2, INTS6
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3 end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 100kDa
NCBI: 26512
UniProt: Q9UL03
Purity: Affinity purification
Sequence: HKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN
Target: INTS6
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics and Nuclear Signaling,DNA / RNA,RNA Processing. Shipping: Ice Bag
Western blot analysis of various lysates using INTS6 Rabbit pAb (A20602) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.