HCoV-HKU1 Spike S2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20614
Artikelname: HCoV-HKU1 Spike S2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20614
Hersteller Artikelnummer: A20614
Alternativnummer: ABB-A20614-20UL,ABB-A20614-100UL,ABB-A20614-500UL,ABB-A20614-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
[Spike protein S1]: attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.
Klonalität: Polyclonal
Molekulargewicht: 152kDa
NCBI: 3200426
UniProt: Q5MQD0
Reinheit: Affinity purification
Sequenz: IVGQEEFIQTNSPKVTIDCSLFVCSNYAACHDLLSEYGTFCDNINSILDEVNGLLDTTQLHVADTLMQGVTLSSNLNTNLHFDVDNINFKSLVGCLGPHCG
Target-Kategorie: HCoV-HKU1 Spike S2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: HCoV-HKU1. Shipping: Ice Bag
Western blot analysis of lysates from Human coronavirus HKU1 (isolate N5) (HCoV-HKU1) Spike Protein (S1+S2 ECDHis Tag), using HCoV-HKU1 Spike S2 Rabbit pAb (A20614) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.