HCoV-HKU1 Spike S2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20614
Article Name: HCoV-HKU1 Spike S2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20614
Supplier Catalog Number: A20614
Alternative Catalog Number: ABB-A20614-20UL,ABB-A20614-100UL,ABB-A20614-500UL,ABB-A20614-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
[Spike protein S1]: attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.
Clonality: Polyclonal
Molecular Weight: 152kDa
NCBI: 3200426
UniProt: Q5MQD0
Purity: Affinity purification
Sequence: IVGQEEFIQTNSPKVTIDCSLFVCSNYAACHDLLSEYGTFCDNINSILDEVNGLLDTTQLHVADTLMQGVTLSSNLNTNLHFDVDNINFKSLVGCLGPHCG
Target: HCoV-HKU1 Spike S2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: HCoV-HKU1. Shipping: Ice Bag
Western blot analysis of lysates from Human coronavirus HKU1 (isolate N5) (HCoV-HKU1) Spike Protein (S1+S2 ECDHis Tag), using HCoV-HKU1 Spike S2 Rabbit pAb (A20614) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.