TCF4/TCF7L2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20770
Artikelname: TCF4/TCF7L2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20770
Hersteller Artikelnummer: A20770
Alternativnummer: ABB-A20770-20UL,ABB-A20770-100UL,ABB-A20770-500UL,ABB-A20770-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TCF4, TCF-4, TCF4/TCF7L2
This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes. Several transcript variants encoding multiple different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 6934
UniProt: Q9NQB0
Reinheit: Affinity purification
Sequenz: TARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKV
Target-Kategorie: TCF7L2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Apoptosis,Wnt -Catenin Signaling Pathway,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Stem Cells,Cardiovascular. Shipping: Ice Bag
Western blot analysis of various lysates using TCF4/TCF7L2 Rabbit pAb (A20770) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.