TCF4/TCF7L2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20770
Article Name: TCF4/TCF7L2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20770
Supplier Catalog Number: A20770
Alternative Catalog Number: ABB-A20770-20UL,ABB-A20770-100UL,ABB-A20770-500UL,ABB-A20770-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TCF4, TCF-4, TCF4/TCF7L2
This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes. Several transcript variants encoding multiple different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 6934
UniProt: Q9NQB0
Purity: Affinity purification
Sequence: TARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKV
Target: TCF7L2
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Apoptosis,Wnt -Catenin Signaling Pathway,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Stem Cells,Cardiovascular. Shipping: Ice Bag
Western blot analysis of various lysates using TCF4/TCF7L2 Rabbit pAb (A20770) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.