MMP9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2095
- Bilder (1)
| Artikelname: | MMP9 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2095 |
| Hersteller Artikelnummer: | A2095 |
| Alternativnummer: | ABB-A2095-20UL,ABB-A2095-100UL,ABB-A2095-500UL,ABB-A2095-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GELB, CLG4B, MMP-9, MANDP2, MMP9 |
| Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 78 kDa |
| NCBI: | 4318 |
| UniProt: | P14780 |
| Reinheit: | Affinity purification |
| Sequenz: | KYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED |
| Target-Kategorie: | MMP9 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis. Shipping: Ice Bag |

