MMP9 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A2095
- Images (1)
| Article Name: | MMP9 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A2095 |
| Supplier Catalog Number: | A2095 |
| Alternative Catalog Number: | ABB-A2095-20UL,ABB-A2095-100UL,ABB-A2095-500UL,ABB-A2095-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GELB, CLG4B, MMP-9, MANDP2, MMP9 |
| Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. |
| Clonality: | Polyclonal |
| Molecular Weight: | 78 kDa |
| NCBI: | 4318 |
| UniProt: | P14780 |
| Purity: | Affinity purification |
| Sequence: | KYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED |
| Target: | MMP9 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse spleen usingMMP9 Rabbit pAb (A2095) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
