PAK1/PAK2/PAK3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21090
Artikelname: PAK1/PAK2/PAK3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21090
Hersteller Artikelnummer: A21090
Alternativnummer: ABB-A21090-100UL,ABB-A21090-20UL,ABB-A21090-500UL,ABB-A21090-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PAKalpha, PAK1/PAK2/PAK3
This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 5058
UniProt: Q13153
Reinheit: Affinity purification
Sequenz: GSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSL
Target-Kategorie: PAK1/PAK2/PAK3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using PAK1/PAK2/PAK3 Rabbit pAb (A21090) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.