PAK1/PAK2/PAK3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21090
Article Name: PAK1/PAK2/PAK3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21090
Supplier Catalog Number: A21090
Alternative Catalog Number: ABB-A21090-100UL,ABB-A21090-20UL,ABB-A21090-500UL,ABB-A21090-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PAKalpha, PAK1/PAK2/PAK3
This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 5058
UniProt: Q13153
Purity: Affinity purification
Sequence: GSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSL
Target: PAK1/PAK2/PAK3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using PAK1/PAK2/PAK3 Rabbit pAb (A21090) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.