HIST1H3D Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A21306
- Bilder (1)
| Artikelname: | HIST1H3D Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A21306 |
| Hersteller Artikelnummer: | A21306 |
| Alternativnummer: | ABB-A21306-100UL,ABB-A21306-20UL,ABB-A21306-1000UL,ABB-A21306-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | H3.4, H3/g, H3FT, H3t, HIST3H3, Histone H3, HIST1H3A, HIST1H3D |
| Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 15KDa |
| NCBI: | 8290 |
| UniProt: | Q16695 |
| Reinheit: | Affinity purification |
| Sequenz: | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Target-Kategorie: | HIST1H3D |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). Shipping: Ice Bag |
|
|
Western blot analysis of lysates from C6 cells, using HIST1H3D Rabbit pAb (A21306) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
