TXLNA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21388
- Bilder (1)
| Artikelname: | TXLNA Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21388 |
| Hersteller Artikelnummer: | A21388 |
| Alternativnummer: | ABB-A21388-100UL,ABB-A21388-20UL,ABB-A21388-500UL,ABB-A21388-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IL14, TXLN, TXLNA |
| Predicted to enable syntaxin binding activity. Predicted to be involved in exocytosis. Predicted to act upstream of or within B cell activation. Located in cytoplasm. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 62kDa |
| NCBI: | 200081 |
| UniProt: | P40222 |
| Reinheit: | Affinity purification |
| Sequenz: | MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQ |
| Target-Kategorie: | TXLNA |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Jurkat cells usingTXLNA Rabbit pAb (A21388) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
