TXLNA Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21388
- Images (1)
| Article Name: | TXLNA Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21388 |
| Supplier Catalog Number: | A21388 |
| Alternative Catalog Number: | ABB-A21388-100UL,ABB-A21388-20UL,ABB-A21388-500UL,ABB-A21388-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | IL14, TXLN, TXLNA |
| Predicted to enable syntaxin binding activity. Predicted to be involved in exocytosis. Predicted to act upstream of or within B cell activation. Located in cytoplasm. |
| Clonality: | Polyclonal |
| Molecular Weight: | 62kDa |
| NCBI: | 200081 |
| UniProt: | P40222 |
| Purity: | Affinity purification |
| Sequence: | MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQ |
| Target: | TXLNA |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Jurkat cells usingTXLNA Rabbit pAb (A21388) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
