FLOT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21408
- Bilder (1)
| Artikelname: | FLOT2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21408 |
| Hersteller Artikelnummer: | A21408 |
| Alternativnummer: | ABB-A21408-20UL,ABB-A21408-100UL,ABB-A21408-1000UL,ABB-A21408-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ESA, ECS1, ESA1, ECS-1, M17S1, FLOT2 |
| Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 47kDa |
| NCBI: | 2319 |
| UniProt: | Q14254 |
| Reinheit: | Affinity purification |
| Sequenz: | LAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV |
| Target-Kategorie: | FLOT2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse heart usingFLOT2 Rabbit pAb (A21408) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
