FLOT2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21408
Article Name: FLOT2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21408
Supplier Catalog Number: A21408
Alternative Catalog Number: ABB-A21408-20UL,ABB-A21408-100UL,ABB-A21408-1000UL,ABB-A21408-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ESA, ECS1, ESA1, ECS-1, M17S1, FLOT2
Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 2319
UniProt: Q14254
Purity: Affinity purification
Sequence: LAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Target: FLOT2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Mouse heart usingFLOT2 Rabbit pAb (A21408) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL