OCRL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21519
- Bilder (1)
| Artikelname: | OCRL Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21519 |
| Hersteller Artikelnummer: | A21519 |
| Alternativnummer: | ABB-A21519-20UL,ABB-A21519-100UL,ABB-A21519-500UL,ABB-A21519-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LOCR, DENT2, NPHL2, OCRL1, Dent-2, INPP5F, OCRL-1, OCRL |
| This gene encodes an inositol polyphosphate 5-phosphatase. This protein is involved in regulating membrane trafficking and is located in numerous subcellular locations including the trans-Golgi network, clathrin-coated vesicles and, endosomes and the plasma membrane. This protein may also play a role in primary cilium formation. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. Alternate splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 104kDa |
| NCBI: | 4952 |
| UniProt: | Q01968 |
| Reinheit: | Affinity purification |
| Sequenz: | MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQRE |
| Target-Kategorie: | OCRL |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using OCRL Rabbit pAb (A21519) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
