OCRL Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21519
- Images (1)
| Article Name: | OCRL Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21519 |
| Supplier Catalog Number: | A21519 |
| Alternative Catalog Number: | ABB-A21519-20UL,ABB-A21519-100UL,ABB-A21519-500UL,ABB-A21519-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | LOCR, DENT2, NPHL2, OCRL1, Dent-2, INPP5F, OCRL-1, OCRL |
| This gene encodes an inositol polyphosphate 5-phosphatase. This protein is involved in regulating membrane trafficking and is located in numerous subcellular locations including the trans-Golgi network, clathrin-coated vesicles and, endosomes and the plasma membrane. This protein may also play a role in primary cilium formation. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. Alternate splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 104kDa |
| NCBI: | 4952 |
| UniProt: | Q01968 |
| Purity: | Affinity purification |
| Sequence: | MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQRE |
| Target: | OCRL |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using OCRL Rabbit pAb (A21519) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
