[KO Validated] NOSIP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21530
- Bilder (1)
| Artikelname: | [KO Validated] NOSIP Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21530 |
| Hersteller Artikelnummer: | A21530 |
| Alternativnummer: | ABB-A21530-100UL,ABB-A21530-20UL,ABB-A21530-500UL,ABB-A21530-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGI-25, NOSIP |
| The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 33kDa |
| NCBI: | 51070 |
| UniProt: | Q9Y314 |
| Reinheit: | Affinity purification |
| Sequenz: | MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLI |
| Target-Kategorie: | NOSIP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and NOSIP knockout (KO)293T cellsusing[KO Validated] NOSIP Rabbit pAb (A21530) at1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:5s. |
Produktgarantie und fachkundiger Support
