[KO Validated] NOSIP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21530
Article Name: [KO Validated] NOSIP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21530
Supplier Catalog Number: A21530
Alternative Catalog Number: ABB-A21530-100UL,ABB-A21530-20UL,ABB-A21530-500UL,ABB-A21530-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CGI-25, NOSIP
The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein.
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 51070
UniProt: Q9Y314
Purity: Affinity purification
Sequence: MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLI
Target: NOSIP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and NOSIP knockout (KO)293T cellsusing[KO Validated] NOSIP Rabbit pAb (A21530) at1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:5s.