[KO Validated] NOSIP Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21530
- Images (1)
| Article Name: | [KO Validated] NOSIP Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21530 |
| Supplier Catalog Number: | A21530 |
| Alternative Catalog Number: | ABB-A21530-100UL,ABB-A21530-20UL,ABB-A21530-500UL,ABB-A21530-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CGI-25, NOSIP |
| The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein. |
| Clonality: | Polyclonal |
| Molecular Weight: | 33kDa |
| NCBI: | 51070 |
| UniProt: | Q9Y314 |
| Purity: | Affinity purification |
| Sequence: | MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLI |
| Target: | NOSIP |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and NOSIP knockout (KO)293T cellsusing[KO Validated] NOSIP Rabbit pAb (A21530) at1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:5s. |
Product Guarantee and Expert Support
