PFN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21539
- Bilder (1)
| Artikelname: | PFN2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21539 |
| Hersteller Artikelnummer: | A21539 |
| Alternativnummer: | ABB-A21539-20UL,ABB-A21539-100UL,ABB-A21539-500UL,ABB-A21539-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PFL, D3S1319E, PFN2 |
| The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 15kDa |
| NCBI: | 5217 |
| UniProt: | P35080 |
| Reinheit: | Affinity purification |
| Sequenz: | MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF |
| Target-Kategorie: | PFN2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Actins. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PFN2 Rabbit pAb (A21539) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:1s. |
Produktgarantie und fachkundiger Support
