PFN2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21539
Article Name: PFN2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21539
Supplier Catalog Number: A21539
Alternative Catalog Number: ABB-A21539-20UL,ABB-A21539-100UL,ABB-A21539-500UL,ABB-A21539-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PFL, D3S1319E, PFN2
The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 5217
UniProt: P35080
Purity: Affinity purification
Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Target: PFN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Actins. Shipping: Ice Bag
Western blot analysis of various lysates using PFN2 Rabbit pAb (A21539) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.