Cyclophilin 40 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21555
- Bilder (1)
| Artikelname: | Cyclophilin 40 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21555 |
| Hersteller Artikelnummer: | A21555 |
| Alternativnummer: | ABB-A21555-20UL,ABB-A21555-100UL,ABB-A21555-1000UL,ABB-A21555-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CYPD, CYP-40, Cyclophilin 40 |
| The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 41kDa |
| NCBI: | 5481 |
| UniProt: | Q08752 |
| Reinheit: | Affinity purification |
| Sequenz: | ILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA |
| Target-Kategorie: | PPID |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC, 1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Rat. ResearchArea: Immunology Inflammation,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat kidney usingCyclophilin 40 Rabbit pAb (A21555) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
