Cyclophilin 40 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21555
- Images (1)
| Article Name: | Cyclophilin 40 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21555 |
| Supplier Catalog Number: | A21555 |
| Alternative Catalog Number: | ABB-A21555-20UL,ABB-A21555-100UL,ABB-A21555-1000UL,ABB-A21555-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CYPD, CYP-40, Cyclophilin 40 |
| The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A. |
| Clonality: | Polyclonal |
| Molecular Weight: | 41kDa |
| NCBI: | 5481 |
| UniProt: | Q08752 |
| Purity: | Affinity purification |
| Sequence: | ILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA |
| Target: | PPID |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|IF/ICC, 1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Rat. ResearchArea: Immunology Inflammation,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat kidney usingCyclophilin 40 Rabbit pAb (A21555) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
