RAB5C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21583
- Bilder (1)
| Artikelname: | RAB5C Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21583 |
| Hersteller Artikelnummer: | A21583 |
| Alternativnummer: | ABB-A21583-20UL,ABB-A21583-100UL,ABB-A21583-1000UL,ABB-A21583-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RABL, L1880, RAB5L, RAB5CL, RAB5C |
| Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 23kDa |
| NCBI: | 5878 |
| UniProt: | P51148 |
| Reinheit: | Affinity purification |
| Sequenz: | MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
| Target-Kategorie: | RAB5C |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from A549 cells usingRAB5C Rabbit pAb (A21583) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
