RAB5C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21583
Article Name: RAB5C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21583
Supplier Catalog Number: A21583
Alternative Catalog Number: ABB-A21583-20UL,ABB-A21583-100UL,ABB-A21583-1000UL,ABB-A21583-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RABL, L1880, RAB5L, RAB5CL, RAB5C
Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 5878
UniProt: P51148
Purity: Affinity purification
Sequence: MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Target: RAB5C
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of lysates from A549 cells usingRAB5C Rabbit pAb (A21583) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.