MCU Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21753
Artikelname: MCU Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21753
Hersteller Artikelnummer: A21753
Alternativnummer: ABB-A21753-100UL,ABB-A21753-20UL,ABB-A21753-500UL,ABB-A21753-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HsMCU, C10orf42, CCDC109A, MCU
Enables calcium channel activity, identical protein binding activity, and uniporter activity. Involved in several processes, including positive regulation of mitochondrial calcium ion concentration, positive regulation of mitochondrial fission, and positive regulation of neutrophil chemotaxis. Acts upstream of or within calcium import into the mitochondrion. Located in mitochondrial inner membrane. Is integral component of mitochondrial inner membrane. Part of uniplex complex.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 90550
UniProt: Q8NE86
Reinheit: Affinity purification
Sequenz: VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSH
Target-Kategorie: MCU
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Cardiovascular,Heart. Shipping: Ice Bag
Western blot analysis of lysates from Mouse spleen, using MCU Rabbit pAb (A21753) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.