MCU Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21753
Article Name: MCU Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21753
Supplier Catalog Number: A21753
Alternative Catalog Number: ABB-A21753-100UL,ABB-A21753-20UL,ABB-A21753-500UL,ABB-A21753-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HsMCU, C10orf42, CCDC109A, MCU
Enables calcium channel activity, identical protein binding activity, and uniporter activity. Involved in several processes, including positive regulation of mitochondrial calcium ion concentration, positive regulation of mitochondrial fission, and positive regulation of neutrophil chemotaxis. Acts upstream of or within calcium import into the mitochondrion. Located in mitochondrial inner membrane. Is integral component of mitochondrial inner membrane. Part of uniplex complex.
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 90550
UniProt: Q8NE86
Purity: Affinity purification
Sequence: VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSH
Target: MCU
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Cardiovascular,Heart. Shipping: Ice Bag
Western blot analysis of lysates from Mouse spleen, using MCU Rabbit pAb (A21753) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.