PDK1/PDPK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21810
- Bilder (1)
| Artikelname: | PDK1/PDPK1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21810 |
| Hersteller Artikelnummer: | A21810 |
| Alternativnummer: | ABB-A21810-20UL,ABB-A21810-100UL,ABB-A21810-500UL,ABB-A21810-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PDK1, PDPK2, PDPK2P, PRO0461, PDK1/PDPK1 |
| Enables 3-phosphoinositide-dependent protein kinase activity, phospholipase activator activity, and phospholipase binding activity. Involved in several processes, including cell surface receptor signaling pathway, regulation of protein kinase activity, and regulation of signal transduction. Acts upstream of or within intracellular signal transduction. Located in cell projection, cytosol, and plasma membrane. Implicated in prostate cancer. Biomarker of lung non-small cell carcinoma. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 63kDa |
| NCBI: | 5170 |
| UniProt: | O15530 |
| Reinheit: | Affinity purification |
| Sequenz: | GSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ |
| Target-Kategorie: | PDPK1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:2000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Signal Transduction,G protein signaling,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Cytoskeleton,Microfilaments,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway,NF-kB Signaling Pathway,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PDK1/PDPK1 Rabbit pAb (A21810) at 1:5000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
