SMARCB1/SNF5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21826
Artikelname: SMARCB1/SNF5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21826
Hersteller Artikelnummer: A21826
Alternativnummer: ABB-A21826-20UL,ABB-A21826-100UL,ABB-A21826-1000UL,ABB-A21826-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RDT, CSS3, INI1, SNF5, Snr1, BAF47, INI-1, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144, SMARCB1/SNF5
The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 6598
UniProt: Q12824
Reinheit: Affinity purification
Sequenz: LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
Target-Kategorie: SMARCB1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag
Western blot analysis of various lysates using SMARCB1/SNF5 Rabbit pAb (A21826) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.