SMARCB1/SNF5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21826
Article Name: SMARCB1/SNF5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21826
Supplier Catalog Number: A21826
Alternative Catalog Number: ABB-A21826-20UL,ABB-A21826-100UL,ABB-A21826-1000UL,ABB-A21826-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RDT, CSS3, INI1, SNF5, Snr1, BAF47, INI-1, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144, SMARCB1/SNF5
The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 6598
UniProt: Q12824
Purity: Affinity purification
Sequence: LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
Target: SMARCB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag
Western blot analysis of various lysates using SMARCB1/SNF5 Rabbit pAb (A21826) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.