FUNDC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22001
Artikelname: FUNDC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22001
Hersteller Artikelnummer: A22001
Alternativnummer: ABB-A22001-20UL,ABB-A22001-100UL,ABB-A22001-1000UL,ABB-A22001-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FUNDC1
This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known.
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 139341
UniProt: Q8IVP5
Reinheit: Affinity purification
Sequenz: VATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
Target-Kategorie: FUNDC1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of lysates from K-562 cells, using FUNDC1 Rabbit pAb (A22001) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.