FUNDC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22001
Article Name: FUNDC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22001
Supplier Catalog Number: A22001
Alternative Catalog Number: ABB-A22001-20UL,ABB-A22001-100UL,ABB-A22001-1000UL,ABB-A22001-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FUNDC1
This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known.
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 139341
UniProt: Q8IVP5
Purity: Affinity purification
Sequence: VATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
Target: FUNDC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of lysates from K-562 cells, using FUNDC1 Rabbit pAb (A22001) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.