NDUFAB1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22019
Artikelname: NDUFAB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22019
Hersteller Artikelnummer: A22019
Alternativnummer: ABB-A22019-100UL,ABB-A22019-20UL,ABB-A22019-1000UL,ABB-A22019-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ACP, ACP1, SDAP, FASN2A, NDUFAB1
Predicted to enable acyl binding activity, acyl carrier activity, and fatty acid binding activity. Involved in mitochondrial respiratory chain complex I assembly and protein lipoylation. Located in mitochondrion and nucleoplasm. Part of mitochondrial respiratory chain complex I. Colocalizes with mitochondrial large ribosomal subunit.
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 4706
UniProt: O14561
Reinheit: Affinity purification
Sequenz: PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Target-Kategorie: NDUFAB1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Lipid Metabolism,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of various lysates using NDUFAB1 Rabbit pAb (A22019) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.