NDUFAB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22019
Article Name: NDUFAB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22019
Supplier Catalog Number: A22019
Alternative Catalog Number: ABB-A22019-100UL,ABB-A22019-20UL,ABB-A22019-1000UL,ABB-A22019-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ACP, ACP1, SDAP, FASN2A, NDUFAB1
Predicted to enable acyl binding activity, acyl carrier activity, and fatty acid binding activity. Involved in mitochondrial respiratory chain complex I assembly and protein lipoylation. Located in mitochondrion and nucleoplasm. Part of mitochondrial respiratory chain complex I. Colocalizes with mitochondrial large ribosomal subunit.
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 4706
UniProt: O14561
Purity: Affinity purification
Sequence: PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Target: NDUFAB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Lipid Metabolism,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of various lysates using NDUFAB1 Rabbit pAb (A22019) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.