COP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22106
- Bilder (1)
| Artikelname: | COP1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22106 |
| Hersteller Artikelnummer: | A22106 |
| Alternativnummer: | ABB-A22106-100UL,ABB-A22106-20UL,ABB-A22106-1000UL,ABB-A22106-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FAP78, RFWD2, CFAP78, RNF200, COP1 |
| Enables ubiquitin protein ligase activity. Involved in positive regulation of proteasomal ubiquitin-dependent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, and response to ionizing radiation. Part of Cul4A-RING E3 ubiquitin ligase complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 80kDa |
| NCBI: | 64326 |
| UniProt: | Q8NHY2 |
| Reinheit: | Affinity purification |
| Sequenz: | YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV |
| Target-Kategorie: | COP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from 293T cells, using COP1 Rabbit pAb (A22106) at 1:600 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
