COP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22106
Article Name: COP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22106
Supplier Catalog Number: A22106
Alternative Catalog Number: ABB-A22106-100UL,ABB-A22106-20UL,ABB-A22106-1000UL,ABB-A22106-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FAP78, RFWD2, CFAP78, RNF200, COP1
Enables ubiquitin protein ligase activity. Involved in positive regulation of proteasomal ubiquitin-dependent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, and response to ionizing radiation. Part of Cul4A-RING E3 ubiquitin ligase complex.
Clonality: Polyclonal
Molecular Weight: 80kDa
NCBI: 64326
UniProt: Q8NHY2
Purity: Affinity purification
Sequence: YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Target: COP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from 293T cells, using COP1 Rabbit pAb (A22106) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL