NANOG Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22115
- Bilder (1)
| Artikelname: | NANOG Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22115 |
| Hersteller Artikelnummer: | A22115 |
| Alternativnummer: | ABB-A22115-100UL,ABB-A22115-20UL,ABB-A22115-500UL,ABB-A22115-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ENK, Stm1, ecat4, 2410002E02Rik, NANOG |
| The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 34kDa |
| NCBI: | 71950 |
| UniProt: | Q80Z64 |
| Reinheit: | Affinity purification |
| Sequenz: | LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI |
| Target-Kategorie: | Nanog |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using NANOG Rabbit pAb (A22115) at 1:700 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
