NANOG Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A22115
- Images (1)
| Article Name: | NANOG Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A22115 |
| Supplier Catalog Number: | A22115 |
| Alternative Catalog Number: | ABB-A22115-100UL,ABB-A22115-20UL,ABB-A22115-500UL,ABB-A22115-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ENK, Stm1, ecat4, 2410002E02Rik, NANOG |
| The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 34kDa |
| NCBI: | 71950 |
| UniProt: | Q80Z64 |
| Purity: | Affinity purification |
| Sequence: | LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI |
| Target: | Nanog |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using NANOG Rabbit pAb (A22115) at 1:700 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
