TRAC Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A22122
- Bilder (1)
| Artikelname: | TRAC Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A22122 |
| Hersteller Artikelnummer: | A22122 |
| Alternativnummer: | ABB-A22122-100UL,ABB-A22122-20UL,ABB-A22122-1000UL,ABB-A22122-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | IMD7, TCRA, TRA , TRAC |
| Enables signaling receptor activity. Involved in T cell mediated cytotoxicity directed against tumor cell target and detection of tumor cell. Part of alpha-beta T cell receptor complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 16kDa |
| NCBI: | 6955 |
| UniProt: | P01848 |
| Reinheit: | Affinity purification |
| Sequenz: | AIELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKTQDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNL |
| Target-Kategorie: | TRA |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse spleen, using TRAC Rabbit pAb (A22122) at 1:700 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
