TRAC Rabbit pAb, Polyclonal
Catalog Number:
ABB-A22122
- Images (1)
| Article Name: | TRAC Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A22122 |
| Supplier Catalog Number: | A22122 |
| Alternative Catalog Number: | ABB-A22122-100UL,ABB-A22122-20UL,ABB-A22122-1000UL,ABB-A22122-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | IMD7, TCRA, TRA , TRAC |
| Enables signaling receptor activity. Involved in T cell mediated cytotoxicity directed against tumor cell target and detection of tumor cell. Part of alpha-beta T cell receptor complex. |
| Clonality: | Polyclonal |
| Molecular Weight: | 16kDa |
| NCBI: | 6955 |
| UniProt: | P01848 |
| Purity: | Affinity purification |
| Sequence: | AIELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKTQDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNL |
| Target: | TRA |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse spleen, using TRAC Rabbit pAb (A22122) at 1:700 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
