HNRNPUL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22236
- Bilder (1)
| Artikelname: | HNRNPUL1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22236 |
| Hersteller Artikelnummer: | A22236 |
| Alternativnummer: | ABB-A22236-100UL,ABB-A22236-20UL,ABB-A22236-1000UL,ABB-A22236-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | E1BAP5, E1B-AP5, HNRPUL1, HNRNPUL1 |
| This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus early-1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by early-1B-55kDa in adenovirus-infected cells. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 42-96 kDa |
| NCBI: | 11100 |
| UniProt: | Q9BUJ2 |
| Reinheit: | Affinity purification |
| Sequenz: | TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIR |
| Target-Kategorie: | HNRNPUL1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using HNRNPUL1 Rabbit pAb (A22236) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
