HNRNPUL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22236
Article Name: HNRNPUL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22236
Supplier Catalog Number: A22236
Alternative Catalog Number: ABB-A22236-100UL,ABB-A22236-20UL,ABB-A22236-1000UL,ABB-A22236-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: E1BAP5, E1B-AP5, HNRPUL1, HNRNPUL1
This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus early-1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by early-1B-55kDa in adenovirus-infected cells.
Clonality: Polyclonal
Molecular Weight: 42-96 kDa
NCBI: 11100
UniProt: Q9BUJ2
Purity: Affinity purification
Sequence: TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIR
Target: HNRNPUL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates, using HNRNPUL1 Rabbit pAb (A22236) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.