[KO Validated] FOXN2 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A22637
- Bilder (1)
| Artikelname: | [KO Validated] FOXN2 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A22637 |
| Hersteller Artikelnummer: | A22637 |
| Alternativnummer: | ABB-A22637-100UL,ABB-A22637-20UL,ABB-A22637-1000UL,ABB-A22637-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HTLF, N2 |
| This gene encodes a forkhead domain binding protein and may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC58450] |
| Molekulargewicht: | 47kDa |
| NCBI: | 3344 |
| UniProt: | P32314 |
| Reinheit: | Affinity purification |
| Sequenz: | QPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSEEDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLISTAKTQNQKQRKK |
| Target-Kategorie: | FOXN2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of extracts from wild type (WT) and FOXN2 knockout (KO) HeLa(KO) cells, using [KO Validated] FOXN2 Rabbit mAb (A22637) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
