[KO Validated] FOXN2 Rabbit mAb, Unconjugated, Monoclonal
Catalog Number:
ABB-A22637
- Images (1)
| Article Name: | [KO Validated] FOXN2 Rabbit mAb, Unconjugated, Monoclonal |
| Biozol Catalog Number: | ABB-A22637 |
| Supplier Catalog Number: | A22637 |
| Alternative Catalog Number: | ABB-A22637-100UL,ABB-A22637-20UL,ABB-A22637-1000UL,ABB-A22637-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | HTLF, N2 |
| This gene encodes a forkhead domain binding protein and may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat. |
| Clonality: | Monoclonal |
| Clone Designation: | [ARC58450] |
| Molecular Weight: | 47kDa |
| NCBI: | 3344 |
| UniProt: | P32314 |
| Purity: | Affinity purification |
| Sequence: | QPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSEEDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLISTAKTQNQKQRKK |
| Target: | FOXN2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of extracts from wild type (WT) and FOXN2 knockout (KO) HeLa(KO) cells, using [KO Validated] FOXN2 Rabbit mAb (A22637) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
