CD328 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22679
- Bilder (1)
| Artikelname: | CD328 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22679 |
| Hersteller Artikelnummer: | A22679 |
| Alternativnummer: | ABB-A22679-100UL,ABB-A22679-20UL,ABB-A22679-1000UL,ABB-A22679-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | p75, QA79, AIRM1, CD328, AIRM-1, CDw328, D-siglec, SIGLEC-7, SIGLECP2, SIGLEC19P, p75/AIRM1 |
| Predicted to enable sialic acid binding activity. Predicted to be involved in cell adhesion. Predicted to be integral component of plasma membrane. Predicted to be active in plasma membrane. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 51kDa |
| NCBI: | 27036 |
| UniProt: | Q9Y286 |
| Reinheit: | Affinity purification |
| Sequenz: | GQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT |
| Target-Kategorie: | SIGLEC7 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience, Cell Type Marker,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Blood,Neuron marker. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from 293F cells, using CD328 Rabbit pAb (A22679) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
