CD328 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22679
Article Name: CD328 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22679
Supplier Catalog Number: A22679
Alternative Catalog Number: ABB-A22679-100UL,ABB-A22679-20UL,ABB-A22679-1000UL,ABB-A22679-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: p75, QA79, AIRM1, CD328, AIRM-1, CDw328, D-siglec, SIGLEC-7, SIGLECP2, SIGLEC19P, p75/AIRM1
Predicted to enable sialic acid binding activity. Predicted to be involved in cell adhesion. Predicted to be integral component of plasma membrane. Predicted to be active in plasma membrane.
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 27036
UniProt: Q9Y286
Purity: Affinity purification
Sequence: GQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Target: SIGLEC7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience, Cell Type Marker,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Blood,Neuron marker. Shipping: Ice Bag
Western blot analysis of lysates from 293F cells, using CD328 Rabbit pAb (A22679) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.