COL4A4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22870
Artikelname: COL4A4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22870
Hersteller Artikelnummer: A22870
Alternativnummer: ABB-A22870-500UL,ABB-A22870-100UL,ABB-A22870-20UL,ABB-A22870-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BFH, ATS2, BFH1, CA44, COL4A4
This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. This particular collagen IV subunit, however, is only found in a subset of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. Mutations in this gene are associated with type II autosomal recessive Alport syndrome (hereditary glomerulonephropathy) and with familial benign hematuria (thin basement membrane disease). Two transcripts, differing only in their transcription start sites, have been identified for this gene and, as is common for collagen genes, multiple polyadenylation sites are found in the 3 UTR.
Klonalität: Polyclonal
Molekulargewicht: 164kDa
NCBI: 1286
UniProt: P53420
Reinheit: Affinity purification
Sequenz: AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS
Target-Kategorie: COL4A4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. Shipping: Ice Bag
Western blot analysis of lysates from 293F cells, using COL4A4 Rabbit pAb (A22870) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.