COL4A4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22870
Article Name: COL4A4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22870
Supplier Catalog Number: A22870
Alternative Catalog Number: ABB-A22870-500UL,ABB-A22870-100UL,ABB-A22870-20UL,ABB-A22870-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BFH, ATS2, BFH1, CA44, COL4A4
This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. This particular collagen IV subunit, however, is only found in a subset of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. Mutations in this gene are associated with type II autosomal recessive Alport syndrome (hereditary glomerulonephropathy) and with familial benign hematuria (thin basement membrane disease). Two transcripts, differing only in their transcription start sites, have been identified for this gene and, as is common for collagen genes, multiple polyadenylation sites are found in the 3 UTR.
Clonality: Polyclonal
Molecular Weight: 164kDa
NCBI: 1286
UniProt: P53420
Purity: Affinity purification
Sequence: AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS
Target: COL4A4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. Shipping: Ice Bag
Western blot analysis of lysates from 293F cells, using COL4A4 Rabbit pAb (A22870) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.